PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn177851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 427aa    MW: 48060.1 Da    PI: 4.6857
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn177851genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK36.31.1e-11201241444
      RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                  ++ledl+ +F  + +d Ak Lgv++++ Kr+CR++GIk W
  Achn177851 201 VLTLEDLQPHFGRKRADDAKILGVSVSTFKRRCRHNGIKHW 241
                 689*************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.705185273IPR003035RWP-RK domain
PfamPF020422.4E-11202241IPR003035RWP-RK domain
SuperFamilySSF542772.1E-18333421No hitNo description
SMARTSM006666.7E-21337419IPR000270PB1 domain
PROSITE profilePS5174519.325337419IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-18338416No hitNo description
PfamPF005641.7E-17338418IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGSSEFTQIP GELLENLRNA ATFSPQISPR LLNDDYWPPY PTDSVSPLPD DDLFTSSRIY  60
GSLSSLSMAL FDFAQIPGDH QISHGFDDRE LLEHCLDFSP QRSPRFLDDD YLPPSPTDSV  120
SPLPVCSEIH ASSKLLINIL DFPWAAIEED LDFSRAPIEE ERSVEIINPS EKLDSMQLDS  180
SEQLMKNAME TRERKCGTKR VLTLEDLQPH FGRKRADDAK ILGVSVSTFK RRCRHNGIKH  240
WNGSECSRSL ELDPKHRETP GEKTTPPCKT PSVIGWAKTG NQVLDNSIVE IEGNLHEQNR  300
FQTENVLKEV EAAVSEGDSK RNWPMLSCFD PAPKQSIVTI KATYGEDTVK FDLASTPRIV  360
ELMEEVAKRL ELESGSFKVK YQDEDQEWIL IACDADFQRC LKFSSSLGNP FIRLLVVAKV  420
SYFGKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-25Nin-like family protein